Protein Info for BWI76_RS23095 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF10114: PocR" amino acids 7 to 164 (158 residues), 151.7 bits, see alignment E=2.3e-48 PF00165: HTH_AraC" amino acids 201 to 242 (42 residues), 42.5 bits, see alignment 8.1e-15 amino acids 254 to 292 (39 residues), 46.3 bits, see alignment 5.2e-16 PF12833: HTH_18" amino acids 215 to 293 (79 residues), 72.3 bits, see alignment E=5e-24

Best Hits

Swiss-Prot: 90% identical to POCR_SALTY: Regulatory protein PocR (pocR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 93% identity to kva:Kvar_0869)

Predicted SEED Role

"Propanediol utilization transcriptional activator" in subsystem Propanediol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7Z7 at UniProt or InterPro

Protein Sequence (303 amino acids)

>BWI76_RS23095 hypothetical protein (Klebsiella michiganensis M5al)
MISASTLNSELINKIAQDFAQATSLAVVVVNIHGDEISELFNFTPFCQLMRQHPQHSTRC
RMSDRCGGLEASKTDALCIYRCHAGLTDFSIPLVIAGHLVGFVLCGQVRLSNDVELVDIL
NVDDRWQADPELLKAFRDVPEMDYSRVIASADLLKLIVENCLKKQLNFVVIKDNPQQPEP
ARASRAVSPHDSKMKKALRYIDAHLSDELRLEDVAAHVYLSPYYFSKLFKKYQGIGFNAW
VNHQRMVSAKELLCHSDWSIASIARNLGFSQTSYFCKVFRQAYQVTPQAYRQQINARSQT
ESI