Protein Info for BWI76_RS23090 in Klebsiella michiganensis M5al

Annotation: cobyrinic acid a,c-diamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 PF01656: CbiA" amino acids 9 to 194 (186 residues), 82.2 bits, see alignment E=4.6e-27 TIGR00379: cobyrinic acid a,c-diamide synthase" amino acids 9 to 452 (444 residues), 449.6 bits, see alignment E=6.6e-139 PF13500: AAA_26" amino acids 81 to 187 (107 residues), 39.7 bits, see alignment E=7.5e-14 PF07685: GATase_3" amino acids 253 to 445 (193 residues), 140.2 bits, see alignment E=1e-44

Best Hits

Swiss-Prot: 81% identical to CBIA_SALTY: Cobyrinate a,c-diamide synthase (cbiA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02224, cobyrinic acid a,c-diamide synthase [EC: 6.3.1.- 6.3.5.9] (inferred from 85% identity to cko:CKO_00802)

MetaCyc: 81% identical to cobyrinate a,c-diamide synthase (Salmonella enterica enterica serovar Typhimurium)
RXN-8769 [EC: 6.3.5.11]

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.- or 6.3.5.11 or 6.3.5.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7N0 at UniProt or InterPro

Protein Sequence (459 amino acids)

>BWI76_RS23090 cobyrinic acid a,c-diamide synthase (Klebsiella michiganensis M5al)
MAARQHAFILAGTGSGCGKTTVTLGLLSLLKQRGMRVQPYKVGPDYLDTGWHTAVSGVAS
CNLDGFMLPEPVLNALFCERMQRADIAVIEGVMGLYDGFGADPGYCSTAAMAKQLGCPVI
LLVDGKAVSTSIAATVMGFQHFDPSLNIAGVIVNRVNSETHYQLLKGAIERYCGLPVLGY
VPRVEGVALPERHLGLVTARESLVNQQPWRDFAHMLAQTLDIERLLTLSQLSSLPAGEWP
PLPRPDAGAGLTLALADDEAFNFYYPDNLTLLERCGVNIVRFSPLHDSELPPCQMIWLGG
GYPEIHAAALAANTPMLAQLQEAHRRGVAIYAECGGLMYIGSTLEDASGEIYPMANLIPG
HSKMGKRLTRFGYCEARAMRQTLLAAPGETLRGHEFHYSDFTPESPAVLACRKVRDGITL
QQWSGGWQVGNTFASYLHLHFAQRPMMLNHWLAAARSAL