Protein Info for BWI76_RS23085 in Klebsiella michiganensis M5al

Annotation: adenosylcobinamide-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 49 to 73 (25 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details TIGR00380: cobalamin biosynthesis protein CobD" amino acids 8 to 311 (304 residues), 256.7 bits, see alignment E=1.5e-80 PF03186: CobD_Cbib" amino acids 8 to 297 (290 residues), 370.1 bits, see alignment E=3.6e-115

Best Hits

Swiss-Prot: 85% identical to COBD_CITK8: Cobalamin biosynthesis protein CobD (cobD) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 85% identity to cko:CKO_00804)

MetaCyc: 81% identical to adenosylcobinamide-phosphate synthase (Salmonella enterica enterica serovar Typhimurium)
Adenosylcobinamide-phosphate synthase. [EC: 6.3.1.10]

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B800 at UniProt or InterPro

Protein Sequence (319 amino acids)

>BWI76_RS23085 adenosylcobinamide-phosphate synthase (Klebsiella michiganensis M5al)
MTLLAWGVAWLLDFIIGDPQSWPHPVRWIGNLIAAVQRGVRRYCHSDVALRLGGAVMWLV
VVGLTWGVSWGVLTLAQAVHPWLGWLVEVWMIFTVLAGRCLAQSARDVEHPLRAGDLAES
RIKLSWIVGRDTSQLEARQINRAVVETVAENTVDGIIAPLFFLLLGGAPLAMAYKAVNTL
DSMVGYKHEKYRAIGMVSARLDDVANFIPARLSWLLISLAALLCGEAGGRALRIGWRDRY
NHSSPNCGWSEAAVAGALGIRLGGPNDYFGQRVEKPWIGDATRDISVDDIPRTIRLMWVS
STLALALFMAVRYWLVGAA