Protein Info for BWI76_RS23080 in Klebsiella michiganensis M5al

Annotation: precorrin-8X methylmutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF02570: CbiC" amino acids 10 to 204 (195 residues), 224.9 bits, see alignment E=3.7e-71

Best Hits

Swiss-Prot: 81% identical to CBIC_SALTY: Cobalt-precorrin-8 methylmutase (cbiC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K06042, precorrin-8X methylmutase [EC: 5.4.1.2] (inferred from 88% identity to esc:Entcl_1764)

MetaCyc: 81% identical to cobalt-precorrin-8 methylmutase (Salmonella enterica enterica serovar Typhimurium)
RXN-8768 [EC: 5.4.99.60]

Predicted SEED Role

"Cobalt-precorrin-8x methylmutase (EC 5.4.1.2)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 5.4.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.1.2 or 5.4.99.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7V6 at UniProt or InterPro

Protein Sequence (210 amino acids)

>BWI76_RS23080 precorrin-8X methylmutase (Klebsiella michiganensis M5al)
MHYIQQPQAIEAKSFDIIGDIIAQTRPDYRFASPLHEAIIKRVIHTTADFDWLDILWFSP
DVLPRLSAALSQPCTLYTDTTMALSGINKTLLAKFGGECRCYISDPRVVAEAKAQGMTRS
MAAVDIAVAEEGEKVFVFGNAPTALFRLLEHDVAVNGVIGVPVGFVGAAESKEALTQSGL
PGIAALGRKGGSNVAAAIVNAILYHLQGAR