Protein Info for BWI76_RS23075 in Klebsiella michiganensis M5al

Annotation: cobalt-precorrin-5B (C(1))-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 171 to 189 (19 residues), see Phobius details PF01888: CbiD" amino acids 17 to 273 (257 residues), 321.4 bits, see alignment E=1.9e-100 TIGR00312: cobalamin biosynthesis protein CbiD" amino acids 24 to 367 (344 residues), 282.7 bits, see alignment E=1.7e-88

Best Hits

Swiss-Prot: 91% identical to CBID_CITK8: Cobalt-precorrin-5B C(1)-methyltransferase (cbiD) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K02188, cobalamin biosynthesis protein CbiD (inferred from 90% identity to stm:STM2032)

MetaCyc: 90% identical to cobalt-precorrin-6A synthase (Salmonella enterica enterica serovar Typhimurium)
RXN-8764 [EC: 2.1.1.195]

Predicted SEED Role

"Cobalt-precorrin-6 synthase, anaerobic" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.195

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7K7 at UniProt or InterPro

Protein Sequence (379 amino acids)

>BWI76_RS23075 cobalt-precorrin-5B (C(1))-methyltransferase (Klebsiella michiganensis M5al)
MSEQSFDTPVWHNGKALRKGYTTGSCATAAAKVAALMVMRQHLIHQVSIVTPSGVTLCLN
VESPHVEGQQAIAAIRKDGGDDVDATHGMLIFARVTLDDSGEITLRGGEGVGTVTRKGIG
LPIGSPAINRTPRHTIESAVREAIGPSRGAEVEIFAPEGEARAQKTYNSRLGILGGISII
GTTGIVTPMSEESWKRSLSLELEIKRAAGLERVVLVPGNHGERFVREQMGIDSQVVVTMS
NFVGYMIEEAVRLGFRQIVLIGHPGKLIKVAAGIFHTHSHIADARMETLVAHLALLGAPL
ALLQLVSECDTTEAAMEHIDAYGFQHIYHHLAERICLRVMQMLRFTKAPPVCDAIMFSFD
NKVLGSNRPIAEIAREMSC