Protein Info for BWI76_RS23070 in Klebsiella michiganensis M5al

Annotation: cobalt-precorrin-7 (C(5))-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 PF00590: TP_methylase" amino acids 1 to 185 (185 residues), 97.3 bits, see alignment E=6.2e-32 TIGR02467: precorrin-6y C5,15-methyltransferase (decarboxylating), CbiE subunit" amino acids 4 to 191 (188 residues), 198.8 bits, see alignment E=3.4e-63

Best Hits

Swiss-Prot: 77% identical to CBIE_SALTY: Cobalt-precorrin-7 C(5)-methyltransferase (cbiE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03399, precorrin-6Y C5,15-methyltransferase [EC: 2.1.1.132] (inferred from 80% identity to cko:CKO_00807)

MetaCyc: 77% identical to cobalt-precorrin-7 (C5)-methyltransferase (Salmonella enterica enterica serovar Typhimurium)
RXN-8767 [EC: 2.1.1.289]

Predicted SEED Role

"Cobalt-precorrin-6y C5-methyltransferase (EC 2.1.1.-)" in subsystem Coenzyme B12 biosynthesis (EC 2.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.132

Use Curated BLAST to search for 2.1.1.- or 2.1.1.132 or 2.1.1.289

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B890 at UniProt or InterPro

Protein Sequence (201 amino acids)

>BWI76_RS23070 cobalt-precorrin-7 (C(5))-methyltransferase (Klebsiella michiganensis M5al)
MLTVVGMGPSGLHLMTPAARDAVASADALVGGKRHLQQFPEFDGERFALGANIAELLVWL
GERDAQKVVVLASGDPLFYGIGTRLIAHFGIDRVRIIPGISAVQYLCAKAGIDMNDIWLT
SSHGRDVCFDELARQRKVAMVTDGRCGPREIAAQLAARGKGYRWMVIGENLAMDNERIRW
LPVSEVDGEYEMNAVVILDER