Protein Info for BWI76_RS23065 in Klebsiella michiganensis M5al
Annotation: cobalt-precorrin-6Y C(15)-methyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 81% identical to CBIT_SALTY: Cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) (cbiT) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: K02191, precorrin-8W decarboxylase [EC: 1.-.-.-] (inferred from 84% identity to cko:CKO_00808)MetaCyc: 81% identical to cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating] monomer (Salmonella enterica enterica serovar Typhimurium)
RXN-8766 [EC: 2.1.1.196]
Predicted SEED Role
"Cobalt-precorrin-6y C15-methyltransferase [decarboxylating] (EC 2.1.1.-)" in subsystem Coenzyme B12 biosynthesis (EC 2.1.1.-)
MetaCyc Pathways
- adenosylcobalamin biosynthesis I (anaerobic) (31/36 steps found)
- cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (14/15 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Anthocyanin biosynthesis
- Benzoxazinone biosynthesis
- Biosynthesis of alkaloids derived from shikimate pathway
- Carotenoid biosynthesis - General
- Flavonoid biosynthesis
- Histidine metabolism
- Insect hormone biosynthesis
- Naphthalene and anthracene degradation
- Nucleotide sugars metabolism
- Phenylpropanoid biosynthesis
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-, 2.1.1.-
Use Curated BLAST to search for 1.-.-.- or 2.1.1.- or 2.1.1.196
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B7R7 at UniProt or InterPro
Protein Sequence (189 amino acids)
>BWI76_RS23065 cobalt-precorrin-6Y C(15)-methyltransferase (Klebsiella michiganensis M5al) MKDELFLRGEKVPMTKEAVRALALAKLELHRASHLIDIGAGTGSVSIEAALQYPSLQVTA VERNPAALQLLDENRQHFACGNIEILPGEAPMVITERADAIFMGGSGGRLDALIDWSWQQ LYPGGRLVMTFILQENLNAALDYLRLKGIEQVDCLQLNVSALTTLGSGHYFKPNNPVFVI ACQKEENHG