Protein Info for BWI76_RS23050 in Klebsiella michiganensis M5al

Annotation: cobalt-precorrin-3B C(17)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 106 to 121 (16 residues), see Phobius details PF00590: TP_methylase" amino acids 1 to 208 (208 residues), 142.3 bits, see alignment E=1.1e-45 TIGR01466: precorrin-3B C17-methyltransferase" amino acids 2 to 239 (238 residues), 355 bits, see alignment E=1e-110

Best Hits

Swiss-Prot: 96% identical to CBIH_SALTY: Probable cobalt-factor III C(17)-methyltransferase (cbiH) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05934, precorrin-3B C17-methyltransferase [EC: 2.1.1.131] (inferred from 93% identity to etr:ETAE_1996)

MetaCyc: 96% identical to cobalt-precorrin-3 (C17)-methyltransferase (Salmonella enterica enterica serovar Typhimurium)
RXN-8761 [EC: 2.1.1.272]

Predicted SEED Role

"Cobalt-precorrin-3b C17-methyltransferase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.131 or 2.1.1.272

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7N2 at UniProt or InterPro

Protein Sequence (241 amino acids)

>BWI76_RS23050 cobalt-precorrin-3B C(17)-methyltransferase (Klebsiella michiganensis M5al)
MLSVIGIGPGSQSMMTMEAIEALQAAEIVVGYKTYTHLVKAFTGDKQVIKTGMCKEIERC
QAAIELAQAGHNVALISSGDAGIYGMAGLVLELVSKQKLDVEVRLIPGMTASIAAASLLG
APLMHDFCHISLSDLLTPWPVIEKRIVAAGEADFVICFYNPRSRGREGHLARAFELLSAS
KSAQTPVGVVKSAGRKKQEKWLTTLGEMDFEPVDMTSLVIVGNKATYIQDGLMITPRGYV
L