Protein Info for BWI76_RS23030 in Klebsiella michiganensis M5al

Annotation: cobalamin biosynthesis protein CbiM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 103 to 130 (28 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 169 to 193 (25 residues), see Phobius details amino acids 205 to 231 (27 residues), see Phobius details TIGR00123: cobalamin biosynthesis protein CbiM" amino acids 31 to 241 (211 residues), 377.8 bits, see alignment E=8.7e-118 PF01891: CbiM" amino acids 32 to 237 (206 residues), 202.6 bits, see alignment E=3.3e-64

Best Hits

Swiss-Prot: 94% identical to CBIM_SALTY: Cobalt transport protein CbiM (cbiM) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02007, cobalt/nickel transport system permease protein (inferred from 98% identity to esc:Entcl_1774)

Predicted SEED Role

"Substrate-specific component CbiM of cobalt ECF transporter" in subsystem Coenzyme B12 biosynthesis or ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7U8 at UniProt or InterPro

Protein Sequence (245 amino acids)

>BWI76_RS23030 cobalamin biosynthesis protein CbiM (Klebsiella michiganensis M5al)
MKLEQQLKQLSFSGLAAALLLIVVPEKAFAMHIMEGFLPPMWALAWWLLFLPCLWYGLVR
LRRIVQEDNNQKVLLALCGAFIFVLSALKIPSVTGSCSHPTGVGLAVILFGPGVVAILGA
IVLLFQALLLAHGGLTTLGANGMSMAVIGPVVGYMVWKMACRAGIRRDVGVFLCAMLADL
VTYFVTSVQLGVAFPDPTAGATGSIVKFMGIFCLTQIPIAIAEGLLTVMIYDQLTKRQLI
TAQGH