Protein Info for BWI76_RS22955 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator GcvA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF00126: HTH_1" amino acids 8 to 67 (60 residues), 80.3 bits, see alignment E=7.8e-27 PF03466: LysR_substrate" amino acids 91 to 292 (202 residues), 135.1 bits, see alignment E=2.4e-43

Best Hits

Swiss-Prot: 97% identical to GCVA_ECO57: Glycine cleavage system transcriptional activator (gcvA) from Escherichia coli O157:H7

KEGG orthology group: K03566, LysR family transcriptional regulator, glycine cleavage system transcriptional activator (inferred from 99% identity to kva:Kvar_0894)

Predicted SEED Role

"Glycine cleavage system transcriptional activator GcvA" in subsystem Glycine cleavage system or Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXX7 at UniProt or InterPro

Protein Sequence (305 amino acids)

>BWI76_RS22955 transcriptional regulator GcvA (Klebsiella michiganensis M5al)
MSKRLPPLNALRVFDAAARHLSFTRAADELFVTQAAVSHQIKSLEDFLGLKLFRRRNRSL
LLTEEGQSYFQDIKEIFSQLTEATRKLQARSAKGALTVSMLPSFAIQWLVPRLTSFNSAY
PGIDVRIQAVDRQEDKLADDVDVAIFYGRGNWPGLRVEKLYAEYLLPVCSPLLLTGDKAL
KTPADLAQHTLLHDASRRDWQTYTRQLGLNHINVQQGPIFSHSAMVLQAAIHGQGVALAN
NVMAQSEIEAGRLVCPFNDVLVSKNAFYLVCHDSQAELGKIAAFRQWILAKAANEQEKFR
FRYEQ