Protein Info for BWI76_RS22935 in Klebsiella michiganensis M5al

Annotation: L-fucose mutarotase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05025: RbsD_FucU
  • amino acids 3 to 139 (137 residues), 126.3 bits, E=6.3e-41

Best Hits

Swiss-Prot: 92% identical to FUCM_ECOLC: L-fucose mutarotase (fucU) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K02431, L-fucose mutarotase [EC: 5.1.3.-] (inferred from 92% identity to eco:b2804)

MetaCyc: 92% identical to L-fucose mutarotase (Escherichia coli K-12 substr. MG1655)
RXN0-5304 [EC: 5.4.99.62]; RXN0-5298 [EC: 5.4.99.62, 5.1.3.29]

Predicted SEED Role

"L-fucose mutarotase" in subsystem L-fucose utilization

MetaCyc Pathways

• superpathway of fucose and rhamnose degradation (11/12 steps found)
• L-fucose degradation I (4/4 steps found)
• ribose phosphorylation (2/2 steps found)
• L-fucose degradation II (1/5 steps found)
• L-fucose degradation III (2/8 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.-, 5.4.99.62

Use Curated BLAST to search for 5.1.3.- or 5.1.3.29 or 5.4.99.62

Sequence Analysis Tools

See A0A285AXR6 at UniProt or InterPro

Protein Sequence (140 amino acids)

>BWI76_RS22935 L-fucose mutarotase (Klebsiella michiganensis M5al)
MLKTISPLISPELLKVLAEMGHGDEIIFSDAHFPVHSMGPQVIRADGLLVSDLLQAIIPL
FELDSYAPPLVMMAAVAGDSLDPQVETRYREALSRPAPCPEIARIDRFAFYERAQKAFAI
VITGERAKYGNILLKKGVTP