Protein Info for BWI76_RS22810 in Klebsiella michiganensis M5al

Annotation: 23S rRNA (uracil(1939)-C(5))-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01938: TRAM
  • amino acids 11 to 66 (56 residues), 41.7 bits, 4e-14
• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 24 to 424 (401 residues), 493.3 bits, E=3.1e-152
• PF05958: tRNA_U5-meth_tr
  • amino acids 262 to 430 (169 residues), 91.6 bits, E=2.3e-29
• PF00398: RrnaAD
  • amino acids 270 to 342 (73 residues), 28.5 bits, E=3.9e-10
• PF01135: PCMT
  • amino acids 273 to 340 (68 residues), 30 bits, E=2e-10
• PF05175: MTS
  • amino acids 279 to 350 (72 residues), 25 bits, E=5.8e-09
• PF02475: Met_10
  • amino acids 284 to 360 (77 residues), 29 bits, E=3.9e-10
• PF13847: Methyltransf_31
  • amino acids 286 to 363 (78 residues), 48.3 bits, E=4.2e-16
• PF13649: Methyltransf_25
  • amino acids 290 to 345 (56 residues), 33.4 bits, 2.8e-11

Best Hits

Swiss-Prot: 90% identical to RLMD_KLEP3: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 91% identity to eae:EAE_01970)

MetaCyc: 79% identical to 23S rRNA m5U1939 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11601 [EC: 2.1.1.190]

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.190

Sequence Analysis Tools

See A0A285AXU1 at UniProt or InterPro

Protein Sequence (447 amino acids)

>BWI76_RS22810 23S rRNA (uracil(1939)-C(5))-methyltransferase (Klebsiella michiganensis M5al)
MAQFYSAKRRVTTRQIITVTVNDLDPFGQGVAHHQGKALFVSGLLPQEQAEVVLVEDKKQ
YARAQVKRRLSDSPQRQAPRCPHFGICGGCQQQHASVELQQQSKRAALARLMKRDVDDII
AASPWGYRRRARLSLNYQPKTQQLQIGFRKANSSEIVDVVQCPVLVPAFGALLPAVRECL
SGLQSLRQLGHVELVQADNGPLMVLRHTAALPAADKEKLERFSQSHGLSLYLAPQSEILE
HIRGEAPWYTSDGLRLVFSPRDFIQVNDGVNQLMVRTALEWLDIQPQDRVLDLFCGMGNF
TLPLAKRAAQVVGVEGVPALVVKARENAALNALHNVTFFHENLEEDVTRQAWAKHGFDKV
LLDPARAGAAGVMLHIIKLAPRRVVYVSCNPATLARDSDVLLQAGYTIQRLAMLDMFPHT
GHLESMVLFEHNNYSNRIEAASSGAGD