Protein Info for BWI76_RS22745 in Klebsiella michiganensis M5al

Annotation: type I-E CRISPR-associated protein Cse1/CasA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 TIGR02547: CRISPR type I-E/ECOLI-associated protein CasA/Cse1" amino acids 5 to 508 (504 residues), 526.3 bits, see alignment E=4.9e-162 PF09481: CRISPR_Cse1" amino acids 6 to 467 (462 residues), 340.5 bits, see alignment E=1.1e-105

Best Hits

KEGG orthology group: None (inferred from 76% identity to stm:STM2943)

Predicted SEED Role

"CRISPR-associated protein, Cse1 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXS3 at UniProt or InterPro

Protein Sequence (519 amino acids)

>BWI76_RS22745 type I-E CRISPR-associated protein Cse1/CasA (Klebsiella michiganensis M5al)
MDSFSLLTTPWLPVRLKDGSTGKLAPVNLADENVVDIAAARADLQGAAWQFLLGLLQCSM
APKNHSRWEDVWFEGLSADVLQRALEPLEPAFQFGADTPSFMQDFEALTGEKVSIASLLP
ETPGAQTIKLNKDHFVKRGITERFCPHCAALALFSLQLNAPSGGQGHRTGLRDGGPMTTL
IELLEYQENRQTSLWRKLWVNVMPQDTAGMYLPAHYDGAIFPWLTNTRSSEPSTGVNTTP
EQVNVLQAYWGMPRRIRLDFNTTHSGRCDLCETQSDELLSWMIMKNYGVNYVGWRHPLTP
YRLPRKEGSGFISVKPPPGGLIWRDWLGLNQEEDSENNTEYPALIVKTTGARSLKDVKIG
LWGFGYDFEKMKARCWYEHHFPLLLTENIIPELRTAALTASRNLSLLRSALKEAWYSDAK
GARGDFSFIDIDFWHLSQERFLELIRDLENGLNADERLNRWQTNIWLFTRSYFDDHVFTN
PYEGVDLKRIMLARKKYFTKSAEKQSAKAAKAKKQEAAE