Protein Info for BWI76_RS22710 in Klebsiella michiganensis M5al

Annotation: Zn-dependent exopeptidase M28

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF04389: Peptidase_M28" amino acids 100 to 325 (226 residues), 106 bits, see alignment E=3.2e-34 PF01546: Peptidase_M20" amino acids 114 to 202 (89 residues), 25.8 bits, see alignment E=1.4e-09

Best Hits

Swiss-Prot: 77% identical to IAP_ECOLI: Alkaline phosphatase isozyme conversion protein (iap) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_01910)

MetaCyc: 77% identical to alkaline phosphatase isozyme conversion protein (Escherichia coli K-12 substr. MG1655)
3.4.11.-

Predicted SEED Role

"Alkaline phosphatase isozyme conversion protein precursor (EC 3.4.11.-)" (EC 3.4.11.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.-

Use Curated BLAST to search for 3.4.11.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXL1 at UniProt or InterPro

Protein Sequence (351 amino acids)

>BWI76_RS22710 Zn-dependent exopeptidase M28 (Klebsiella michiganensis M5al)
MFSALCRRLLPLALGAGFVFSAAPAFSAPGETANAQARHIATFFPGRMTGTPAEMLSADY
LRQQFAQMGYQSDVRSFNTRYVYTDSSQRKNWHNVTGSTVIAAHEGQSRQQIIIMAHLDT
YAPQSDKDVENNLGGLTLQGIDDNAMGLGVMLELAEQLKNVPTRYGIRFVATSGEEEGRL
GAQNLLKRMSDAEKKNTLLVINLDNLVVGDKLYFNSGRSTPASVRKLTRDRALFIARSHG
IAAFINPGLNRDFPKGTGCCNDASVFDNAGIPVLSVEATNWSLGKKDGYQQRGKSRSFPD
GTSWHNLQLDNLQYIDKALPGRIEHRGRDVMKVMLPLVKELAKAEKKPTSK