Protein Info for BWI76_RS22675 in Klebsiella michiganensis M5al

Annotation: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF01128: IspD" amino acids 8 to 229 (222 residues), 298.7 bits, see alignment E=3e-93 TIGR00453: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase" amino acids 9 to 227 (219 residues), 258.1 bits, see alignment E=2.9e-81 PF12804: NTP_transf_3" amino acids 10 to 161 (152 residues), 51 bits, see alignment E=1.9e-17

Best Hits

Swiss-Prot: 93% identical to ISPD_KLEP7: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (ispD) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K00991, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC: 2.7.7.60] (inferred from 93% identity to kva:Kvar_0956)

MetaCyc: 87% identical to 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Escherichia coli K-12 substr. MG1655)
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase. [EC: 2.7.7.60]

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)" in subsystem Isoprenoid Biosynthesis or Teichoic and lipoteichoic acids biosynthesis or polyprenyl synthesis (EC 2.7.7.60)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXP2 at UniProt or InterPro

Protein Sequence (236 amino acids)

>BWI76_RS22675 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Klebsiella michiganensis M5al)
MAATFPGVCAVVPAAGFGRRMQTECPKQYLSIGNKTILEHAVAALLANPRIRRVVIAVSP
GDVRFSQLPLANHPQITVVDGGTERADSVLAGLKVLGEADWVLVHDAARPCLHQDDLSRL
LQLCETSRTGGILAAPVRDTMKRAEPGRAAIAHTVERNDLWHALTPQFFPRELLVDCLTR
ALNEGATITDEASALEYCGFHPELVAGRADNIKVTRPEDLALAEFYLTRSRHQEKA