Protein Info for BWI76_RS22670 in Klebsiella michiganensis M5al

Annotation: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02542: YgbB
  • amino acids 1 to 154 (154 residues), 233.3 bits, E=8e-74
• TIGR00151: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
  • amino acids 2 to 155 (154 residues), 237.4 bits, E=3.5e-75

Best Hits

Swiss-Prot: 99% identical to ISPF_KLEP3: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (ispF) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K01770, 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC: 4.6.1.12] (inferred from 98% identity to eco:b2746)

MetaCyc: 98% identical to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (Escherichia coli K-12 substr. MG1655)
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase. [EC: 4.6.1.12]

Predicted SEED Role

"2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 4.6.1.12)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (12/12 steps found)
• taxadiene biosynthesis (engineered) (12/13 steps found)
• methylerythritol phosphate pathway I (9/9 steps found)
• methylerythritol phosphate pathway II (9/9 steps found)
• isoprene biosynthesis I (9/10 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.12

Sequence Analysis Tools

See A0A285AXK7 at UniProt or InterPro

Protein Sequence (159 amino acids)

>BWI76_RS22670 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (Klebsiella michiganensis M5al)
MRIGHGFDVHAFGGEGPIIIGGVRVPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKL
FPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDL
GCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLRKAEK