Protein Info for BWI76_RS22650 in Klebsiella michiganensis M5al

Annotation: lipoprotein NlpD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details PF01476: LysM" amino acids 113 to 155 (43 residues), 41.3 bits, see alignment 1.2e-14 PF01551: Peptidase_M23" amino acids 272 to 365 (94 residues), 112.7 bits, see alignment E=8e-37

Best Hits

Swiss-Prot: 80% identical to NLPD_SALDU: Murein hydrolase activator NlpD (nlpD) from Salmonella dublin

KEGG orthology group: None (inferred from 87% identity to eae:EAE_01850)

Predicted SEED Role

"Lipoprotein NlpD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXQ2 at UniProt or InterPro

Protein Sequence (372 amino acids)

>BWI76_RS22650 lipoprotein NlpD (Klebsiella michiganensis M5al)
MSAGSPKFTLSRIAALSLVSLWLAGCSSSNNPPAPVSSAGGASSSSTNSGMLITPPSNNV
PQARPVQTQPVQTQPAQIQPMAQEPVQTVNGKIVYNRKYGDIPKGSYTGGSTYTVKRGDT
LFYIAWVTGNDFRDLAQRNNIPAPYGLNVGQTLQVGNASGQPITGDNPVAQASVKASNGG
MLTANSAQKSTAVVASQPTITYSESSGEQSANKMLPNNKPATTTAVAPVTAPAVSTTQST
ASSTSTSSPISSWRWPTDGKVIENFSGAEGGNKGIDIAGSKGQAIVATADGRVVYAGNAL
RGYGNLIIIKHNDDYLSAYAHNDTMLVKEQQDIKAGQKIATMGSTGTSSTRLHFEIRYKG
KSVNPLQYLPQR