Protein Info for BWI76_RS22615 in Klebsiella michiganensis M5al

Annotation: phenolic acid decarboxylase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 TIGR00148: decarboxylase, UbiD family" amino acids 6 to 441 (436 residues), 420 bits, see alignment E=4.9e-130 PF20695: UbiD_N" amino acids 10 to 89 (80 residues), 51.9 bits, see alignment E=1e-17 PF01977: UbiD" amino acids 110 to 309 (200 residues), 183.5 bits, see alignment E=4.5e-58 PF20696: UbiD_C" amino acids 315 to 438 (124 residues), 110.4 bits, see alignment E=9.4e-36

Best Hits

Swiss-Prot: 97% identical to YCLC_ECO57: Phenolic acid decarboxylase (edcC) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 97% identity to efe:EFER_0331)

Predicted SEED Role

"Hydroxyaromatic non-oxidative decarboxylase protein C (EC 4.1.1.-)" (EC 4.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXJ2 at UniProt or InterPro

Protein Sequence (475 amino acids)

>BWI76_RS22615 phenolic acid decarboxylase subunit C (Klebsiella michiganensis M5al)
MAFDDLRSFLQALDDQGQLLKISEEVNAEPDLAAAANATGRIGDGAPALWFDNIRGFTDA
RVAMNTIGSWQNHAISLGLPPNTPVKNQIDEFIRRWDKFPVTPERRANPAWAENTVDGEA
INLFDILPLFRLNDGDGGFYLDKACVVSRDPLDPDNFGKQNVGIYRMEVKGKRKLGLQPV
PMHDIALHLHKAEERGEDLPIAITLGNDPIITLMGATPLKYDQSEYEMAGALRESPYPIA
TAPLTGFDVPWGSEVILEGVIESRKREIEGPFGEFTGHYSGGRNMTVVRIDKVSYRSKPI
FESLYLGMPWTEIDYLMGPATCVPLYQQLKAEFPEVQAVNAMYTHGLLAIISTKKRYGGF
ARAVGLRAMTTPHGLGYVKMVIMVDEDVDPFNLPQVMWALSSKVNPAGDLVQLPNMSVLE
LDPGSSPAGITDKLIIDATTPVAPDLRGHYSQPVQDLPETKAWAEKLTAMLANRK