Protein Info for BWI76_RS22585 in Klebsiella michiganensis M5al

Annotation: fimbrial usher protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 822 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13954: PapC_N" amino acids 30 to 170 (141 residues), 125 bits, see alignment E=3.5e-40 PF00577: Usher" amino acids 189 to 738 (550 residues), 484 bits, see alignment E=1.1e-148 PF13953: PapC_C" amino acids 750 to 806 (57 residues), 37.4 bits, see alignment 2.7e-13

Best Hits

Swiss-Prot: 55% identical to PMFC_PROMH: Outer membrane usher protein PmfC (pmfC) from Proteus mirabilis (strain HI4320)

KEGG orthology group: None (inferred from 75% identity to cro:ROD_34981)

Predicted SEED Role

"Outer membrane fimbrial usher porin precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXR4 at UniProt or InterPro

Protein Sequence (822 amino acids)

>BWI76_RS22585 fimbrial usher protein (Klebsiella michiganensis M5al)
MSAEQKIKIILSQMLFFCCTSMAYASTDVEFNTDVLDAADRDNIDLTRFATDNYVPPGEY
LLDIKINGQAVGQQKVRYLASKDQKHTQACINGEILARLALKEDAQQKVAQPFADCYDLL
SLPGATLSNYAGVLDITVPQAWMKYNDPNWTPPERWDQGIGGFLLDYSLTGQYTRQLDMH
EDYSTLSGYGQTGVNLGGWRLRGEYQTSYYSATHQFDFDMNQIYAYRPLPMMAAKLTAGE
IYLDSQVFDTVRFTGLNLASDERQLPPNLQGYAPEIRGLAKTNAKVTVKQSGRIIYETTV
PAGPFNIQDLRSSVRGTLDVQVEEQDGSISTFQVNTANIPYLTRPGYVRYNVAIGAPSRY
SHKIQGPGFASGDFSWGITNAWSLYGGLQSAGAEYTAVSAGIGRDLSVLGALSLDATESY
SQQSNQKRLKGTSFKLSYAKTFDEYNSSITFAGYRFSQEDFRSFSQYLNERYEGYDSLGR
EKEVYTITGNKTFWANEPGKATTVFLTYTHQNYWNRSSQDRYGISLGRSFNVGNIRGITT
NISAYRSDYEGRKDDSIAFSLSIPVGDSKWSGLDVQTNNGKTSPMLSYTDSSDYNNLWRL
RAGASQSGYANVDGYYQRRSQYAEINSNASYQQDHYLSLSSTLRGGFTATRHGAAIHNSG
ATLNTARVMVNTNGIGDVPLNDGKSRTNNFGIAVIPDIVSYNSFDTRVDVDAMSESIEPA
KAISTATLTEGAIGYQTFGMAQGEKMMGIIRLADGTYPPFGAEVINGDGVSVSMIMEGGQ
GWLAGVNPHELLSVVWSGKKQCQIAIPPTIERRSTAALLPCK