Protein Info for BWI76_RS22580 in Klebsiella michiganensis M5al

Annotation: molecular chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00345: PapD_N" amino acids 26 to 144 (119 residues), 121.2 bits, see alignment E=2.6e-39 PF02753: PapD_C" amino acids 169 to 226 (58 residues), 50.7 bits, see alignment E=1.8e-17

Best Hits

Swiss-Prot: 62% identical to PMFD_PROMH: Chaperone protein PmfD (pmfD) from Proteus mirabilis (strain HI4320)

KEGG orthology group: None (inferred from 79% identity to cro:ROD_34991)

Predicted SEED Role

"Pi-fimbriae chaperone protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXM2 at UniProt or InterPro

Protein Sequence (247 amino acids)

>BWI76_RS22580 molecular chaperone (Klebsiella michiganensis M5al)
MSITSNKLCWMGILMLAAVSGTAQAGVSLDRTRLIITGKDSSASANLTNTSPDIPFLAQS
WVEDSKGNKITSPLVVLPPLQRINGGQKGVARVTKTDGINQLPQDRESLFYLSVREIPPK
PDKANVLQLAMQSRIKLFFRPTAIIPKSKSEIWQDQVVFQKSGNKMTAQNPTPYYITIIS
LSRVKGEKITKFPGIMIAPKSSLEFSVTDGGVREFAMMYVNDYGGHPELKYRCEGNTCKA
LPPSQQG