Protein Info for BWI76_RS22575 in Klebsiella michiganensis M5al

Annotation: fimbrial protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00419: Fimbrial" amino acids 46 to 208 (163 residues), 51.2 bits, see alignment E=9.2e-18

Best Hits

KEGG orthology group: None (inferred from 59% identity to cro:ROD_35001)

Predicted SEED Role

"MrfE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXI5 at UniProt or InterPro

Protein Sequence (209 amino acids)

>BWI76_RS22575 fimbrial protein (Klebsiella michiganensis M5al)
MKTRLSLLALFVFGISMPALADADIPLQPQHYNRDHQGEDGGNVIFNGSVYASPCVLAPQ
SRLQIIEMGEISARRFHQAGDRSQPVLVRVELRDCLKGASQARDSIASRTTGSSKHLYTT
GEQAVQLTFIGESDEHNRQLLRLTGSISGAGIRLLDVKERALDINQTQPPFIVKTGDSSL
TFIAVLESTGRNVTAGNFSGLLRLKMEYL