Protein Info for BWI76_RS22565 in Klebsiella michiganensis M5al

Annotation: fimbrial protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00419: Fimbrial" amino acids 32 to 182 (151 residues), 78.8 bits, see alignment E=2.7e-26

Best Hits

Swiss-Prot: 43% identical to PMFF_PROMH: Putative minor fimbrial subunit PmfF (pmfF) from Proteus mirabilis (strain HI4320)

KEGG orthology group: None (inferred from 60% identity to cro:ROD_35021)

Predicted SEED Role

"FIG00510011: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>BWI76_RS22565 fimbrial protein (Klebsiella michiganensis M5al)
MRQLIASMILIGSLPAAAPAHAIGELIGGDLNFKGTVVAHGCSIVPSSKNITVDFGQIST
RTLYAEGKSQPKAFVIELQDCSTDVFNSVTVTFSGTENANMSDRLAITPVAPQTASGIGI
GFEESNGTAILLNTPTTAVAISDANMQLNFKAFVEGEPDALSNKTLETGAFQATANYTLN
YQ