Protein Info for BWI76_RS22540 in Klebsiella michiganensis M5al

Annotation: ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 703 transmembrane" amino acids 165 to 184 (20 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 282 to 299 (18 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details amino acids 390 to 414 (25 residues), see Phobius details amino acids 421 to 441 (21 residues), see Phobius details PF03412: Peptidase_C39" amino acids 8 to 133 (126 residues), 81.5 bits, see alignment E=1e-26 PF00664: ABC_membrane" amino acids 169 to 432 (264 residues), 44.6 bits, see alignment E=3e-15 PF00005: ABC_tran" amino acids 495 to 644 (150 residues), 98.2 bits, see alignment E=1.3e-31

Best Hits

Predicted SEED Role

"Putative secretion ATPase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXQ3 at UniProt or InterPro

Protein Sequence (703 amino acids)

>BWI76_RS22540 ABC transporter ATP-binding protein/permease (Klebsiella michiganensis M5al)
MKKIIPDMVFQEETNECGLSCIAMLAQTQNIQCSLPALREIFPASDHGTSLSDLSLILQQ
IGIATAPVLFDHEELHALPFPSILHYGASHYVLLAWRKGDYVCVMNPAIGQQWLPFSALK
KEISGYALILEESPGVIDQQAPVITGAQQEMPRAMSLKETAAVPGIYKLMLLTFLVSLTL
FLMPTMVSRAINQAFSDVQNTSFPYLWFILAFVISTLLALGVRVISERFIRRFVLLKSDI
GFSRLLNNPLRFFEKRAPGDVFSRFIAWQGGMLQKIELDNGLRSDWIICVIAIGIMFWIS
PVLALISAVGIVAMGLISVWAIFRDRWYTQQLQLKSATLNDFFMETLQGVLTIKTAGLET
QRKAQFARLSHDLFTCLQRQKVYQQVKEGLYQLTGSLEMVVFMLVVLPLVSAKLISLGDF
FAYSFLRQIFTSYVTRIFYAVIRKSQLHVIDTRAQGLFTREEPATPQLSPLRGEAVPQLA
FEAVSFHYAPQSPVLNDVDLRLEPGDRVAIVGDSGAGKSTLLRLMAGLFSAQHGRILLDG
EEATARQLASQVWLQSQEDILFNASVLQNITLFDPWYSDSDRGRVEALVDKMALGPVVQA
LPGGMEALIRESHSALSLGQRQRLMLARALYSNRPILLCDEPTANLDDETAETVIAALCQ
HCREQGKTLIVVTHSAPILHHFTRVYRLDEGELRDIAQGALGQ