Protein Info for BWI76_RS22530 in Klebsiella michiganensis M5al

Annotation: macrolide ABC transporter permease/ATP-binding protein MacB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 647 transmembrane" amino acids 272 to 292 (21 residues), see Phobius details amino acids 521 to 547 (27 residues), see Phobius details amino acids 571 to 593 (23 residues), see Phobius details amino acids 607 to 630 (24 residues), see Phobius details PF00005: ABC_tran" amino acids 25 to 173 (149 residues), 114.1 bits, see alignment E=1.2e-36 PF12704: MacB_PCD" amino acids 273 to 489 (217 residues), 130.8 bits, see alignment E=1.3e-41 PF02687: FtsX" amino acids 526 to 640 (115 residues), 70.2 bits, see alignment E=2.5e-23

Best Hits

KEGG orthology group: K05685, macrolide transport system ATP-binding/permease protein [EC: 3.6.3.-] (inferred from 62% identity to yep:YE105_C0717)

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXH5 at UniProt or InterPro

Protein Sequence (647 amino acids)

>BWI76_RS22530 macrolide ABC transporter permease/ATP-binding protein MacB (Klebsiella michiganensis M5al)
MAEPLIVLHNVTRHFTAGTQIIPVLKSVSLTIMPGEMVAIMGASGSGKSTLMNIIGCLDK
PSSGEVYINDIAIHQADSASLAELRSRWLGFIFQRYHLMPYLTAEENIAIPALYTAMPAA
ERQARIALLAEKLGIDGRLQHKPAQLSGGQQQRVSVCRALINGAQIILADEPTGALDSVS
GRALTDVLHQLNADGHTVIIVTHDREVAQQAQRIVEISDGQVVADHAYSARDNRDVQRLP
AVQDNGRASLSRSIGESVRMAWRSLLGHRMRAFLSMLGIIIGISSVVSSMAVGEGARQSI
MNEIGKLGNTTLEIRPGTGWGSKRPDMERALSLDDIASLGRQPWVQGVSPIVSSMTTAVR
QGFDSSIILSGVSAEYFSLQGMRFIQGNGFTHRDVEDREPVLVLDETSRETLFPGNEDPL
GKIVQIAGAPWRVIGIASKPGPKVVSGFMSAWIPYTSLLQRISGDKPLEALTLRFQETLS
PQDAARRAERHLIREHGKKDFFVQTDEQLAKALQKTSDSMSLLITAIAAISLLVGGVGVM
NIMLVSVTERTHEIGIRLSVGARPSDIMHQFLIEAVMICALGGLTGVLGSWAAGNLFALL
TQEFSMVFTWLPVAMACGFSALIGLTFGYFPARRAARLNPTEALARE