Protein Info for BWI76_RS22525 in Klebsiella michiganensis M5al

Annotation: cation efflux system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02321: OEP" amino acids 63 to 245 (183 residues), 75.1 bits, see alignment E=3.4e-25 amino acids 273 to 446 (174 residues), 78.9 bits, see alignment E=2.3e-26

Best Hits

KEGG orthology group: None (inferred from 64% identity to enc:ECL_00382)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXI8 at UniProt or InterPro

Protein Sequence (465 amino acids)

>BWI76_RS22525 cation efflux system protein (Klebsiella michiganensis M5al)
MRPLTLLPFIVLLTGCGNLTRSDYQRPLLSVPESWQRMEGQSNALAPENAPRWWDRFGDQ
RLSRVVGQVLESNNDLAAAALTLKQARLAAGLTQTNISPDATLSGTGNNSKPLNSGGSQE
SYSASLSLSYELDLWGKLARIREQSEWEAVASEQDYRATILSTIDTTAQLYWNIALLNQQ
MAYQATSLDIARQTLAQIESWQRAGKVGLLDVLQARQTVISRQNQLLSLKQQRAISRNAL
ALLLNRPPAQHTDESAALDVRQHIAIASATPLAALASRPDLQAAESRLRAALAGSDAARL
SFYPTLSLQGTLSAGSQLFHQWFNDPLRTVGSSVSAPFIQWNTVQLTVEQASVKVQQEAV
NFRRTAYTALSEVDNAMEKRLNADEQRERLLQSLLLGEQRLALTESRYQAGAVDYQTLLN
AQDALLDVQNSLAQNQYDYLYATLQLWLAQGGNNPQQRTSQNESQ