Protein Info for BWI76_RS22470 in Klebsiella michiganensis M5al

Annotation: transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 54 to 75 (22 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 235 to 261 (27 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details amino acids 306 to 323 (18 residues), see Phobius details PF01032: FecCD" amino acids 15 to 324 (310 residues), 308.7 bits, see alignment E=2.1e-96

Best Hits

Swiss-Prot: 62% identical to HMUU_YERPE: Hemin transport system permease protein HmuU (hmuU) from Yersinia pestis

KEGG orthology group: None (inferred from 88% identity to eae:EAE_01770)

Predicted SEED Role

"Hemin ABC transporter, permease protein" in subsystem Hemin transport system or Iron acquisition in Vibrio or Putative hemin transporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXL5 at UniProt or InterPro

Protein Sequence (331 amino acids)

>BWI76_RS22470 transporter permease (Klebsiella michiganensis M5al)
MRSHPARHLWLMTLLLIVLTLLATTLGAMRLPLTSLLPAGDEILRNIWLTIRLPRVLLAL
LVGAALALSGCVMQGLFRNPLADPGLLGISGGAALAVACWLVLPLSLPALVALYAPMLAA
FIGSTAVMVVIFILSQAGDASLSRLLLVGIAINALCGALVGVLAWISNDTQLRQLSLWGM
GSLGQAEWSTLLVAATLMIPASLVVWAMASRLNLLQLGDEEAHYLGVNVRALQRLLLLCS
ALLVASAVAISGIIGFIGLVVPHLMRMWLGPDHRGLVPGSLLCGAILLLLADTLARTVAA
PAEMPVGLLTSVLGAPWFLWLIFRQEKETHG