Protein Info for BWI76_RS22460 in Klebsiella michiganensis M5al

Annotation: hemin-degrading factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 PF06228: ChuX_HutX" amino acids 31 to 155 (125 residues), 97.8 bits, see alignment E=4.9e-32 amino acids 204 to 334 (131 residues), 95.5 bits, see alignment E=2.6e-31 PF05171: HemS" amino acids 35 to 158 (124 residues), 124.5 bits, see alignment E=2.6e-40 amino acids 207 to 338 (132 residues), 134.1 bits, see alignment E=2.7e-43

Best Hits

Swiss-Prot: 61% identical to HMUS_YERPE: Hemin transport protein HmuS (hmuS) from Yersinia pestis

KEGG orthology group: K07225, putative hemin transport protein (inferred from 85% identity to kpe:KPK_1034)

MetaCyc: 66% identical to heme oxygenase (hematinate-forming) (Escherichia coli O157:H7)
RXN-17522

Predicted SEED Role

"Hemin transport protein HmuS" in subsystem Heme, hemin uptake and utilization systems in GramPositives or Hemin transport system

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXL4 at UniProt or InterPro

Protein Sequence (346 amino acids)

>BWI76_RS22460 hemin-degrading factor (Klebsiella michiganensis M5al)
MHNTQPQHTPLWQRYLATKAQSSAKYARDIAAEMGISEAELTEARQGYDAVRLQDDARAI
LTALEAVGETKCICRNEYAVHEQVGEFTHQHLSGHAGLVLNPRALDLRLFLSQWASAFHL
SDNGRQSIQFFDPHGDALLKVYTTGNTDMAAWDALIAAHTQQSPAPLAIRPADPLKYADA
ADGEALENEWRAMTDVHQFFGLLRKYNLSRQQAFRLVSDDLACRIDTQTLPGLLETIRQD
GNEIMIFVGNRGCVQIFTGALEKVAPMRGWLNIFNAAFTLHLREESVDEIWVTRKPTSDG
HVTSVELFAKDGTQIAQLYGQRSEGHPEQAQWRAQVDGLTTEGLLA