Protein Info for BWI76_RS22440 in Klebsiella michiganensis M5al

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 56 to 82 (27 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details PF00950: ABC-3" amino acids 10 to 264 (255 residues), 265.2 bits, see alignment E=6.6e-83 PF01032: FecCD" amino acids 40 to 269 (230 residues), 30 bits, see alignment E=2.8e-11

Best Hits

Swiss-Prot: 54% identical to Y359_HAEIN: Probable iron transport system membrane protein HI_0359 (HI_0359) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 88% identity to eae:EAE_01725)

Predicted SEED Role

"Manganese ABC transporter, inner membrane permease protein SitD" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXJ6 at UniProt or InterPro

Protein Sequence (284 amino acids)

>BWI76_RS22440 iron ABC transporter permease (Klebsiella michiganensis M5al)
MLSALLEPFQFSFMVNAMLVAAIVAVPCALLSVFLVLKGWALMGDAMSHAVFPGVVVAYI
LGIPFAIGAFIAGLFCAIATGYLDDNSRIKRDTIMGIVFSGMFGAGLVLYVSIQSEVHLD
HILFGDMLGISASDIVQTSLIALAIALIIGLKWRDFLLHAFDPQQAKASGLRCGLLHYGL
LCMIALTIVATLKAVGIILSISLLIAPGAIALLLTRRFVSALLLAVAIALSCSLGGVWLS
FYLDSAPAPTIVVLFTVLFVIAFIWTSVRDSQTTAHSGEAPGRG