Protein Info for BWI76_RS22440 in Klebsiella michiganensis M5al
Annotation: iron ABC transporter permease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 54% identical to Y359_HAEIN: Probable iron transport system membrane protein HI_0359 (HI_0359) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
KEGG orthology group: None (inferred from 88% identity to eae:EAE_01725)Predicted SEED Role
"Manganese ABC transporter, inner membrane permease protein SitD" in subsystem Transport of Manganese
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285AXJ6 at UniProt or InterPro
Protein Sequence (284 amino acids)
>BWI76_RS22440 iron ABC transporter permease (Klebsiella michiganensis M5al) MLSALLEPFQFSFMVNAMLVAAIVAVPCALLSVFLVLKGWALMGDAMSHAVFPGVVVAYI LGIPFAIGAFIAGLFCAIATGYLDDNSRIKRDTIMGIVFSGMFGAGLVLYVSIQSEVHLD HILFGDMLGISASDIVQTSLIALAIALIIGLKWRDFLLHAFDPQQAKASGLRCGLLHYGL LCMIALTIVATLKAVGIILSISLLIAPGAIALLLTRRFVSALLLAVAIALSCSLGGVWLS FYLDSAPAPTIVVLFTVLFVIAFIWTSVRDSQTTAHSGEAPGRG