Protein Info for BWI76_RS22435 in Klebsiella michiganensis M5al

Annotation: iron ABC transporter permease AfeC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 56 to 81 (26 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 173 to 190 (18 residues), see Phobius details amino acids 196 to 213 (18 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details PF00950: ABC-3" amino acids 10 to 264 (255 residues), 279.2 bits, see alignment E=3.6e-87 PF01032: FecCD" amino acids 64 to 243 (180 residues), 38.5 bits, see alignment E=7.3e-14

Best Hits

Swiss-Prot: 70% identical to YFEC_YERPE: Chelated iron transport system membrane protein YfeC (yfeC) from Yersinia pestis

KEGG orthology group: None (inferred from 99% identity to eae:EAE_01720)

Predicted SEED Role

"Manganese ABC transporter, inner membrane permease protein SitC" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXF7 at UniProt or InterPro

Protein Sequence (282 amino acids)

>BWI76_RS22435 iron ABC transporter permease AfeC (Klebsiella michiganensis M5al)
MSWLLEPFGYQYMLNAMWVSALVGGVCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYML
GLPFALGAFLSGGLAAGSMLFLNQRSKLKEDAIIGLIFSSFFGIGLFMVSLNPTSVNIQT
IILGNILAIAPEDIIQLAAIGFISMAILLLKWKDLMVTFFDENHARSIGLNTSGLKLLFF
TLLAACTVAALQTVGAFLVICLVVTPGATAWLLTDRFPRLLAIAVAIGSLTSFFGAWLSY
YLDGATGGIIVVAQTLLFLTAFVFAPKHGLLASRRRAREASC