Protein Info for BWI76_RS22430 in Klebsiella michiganensis M5al

Annotation: manganese/iron transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF00005: ABC_tran" amino acids 24 to 171 (148 residues), 100.6 bits, see alignment E=1.2e-32 PF13304: AAA_21" amino acids 133 to 204 (72 residues), 31.7 bits, see alignment E=1.6e-11

Best Hits

Swiss-Prot: 62% identical to YFEB_YERPE: Chelated iron transport system membrane protein YfeB (yfeB) from Yersinia pestis

KEGG orthology group: None (inferred from 92% identity to eae:EAE_01715)

Predicted SEED Role

"Manganese ABC transporter, ATP-binding protein SitB" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXG4 at UniProt or InterPro

Protein Sequence (273 amino acids)

>BWI76_RS22430 manganese/iron transporter ATP-binding protein (Klebsiella michiganensis M5al)
MSNELPGLAVNNVSVTYRNGHTALRDASFRVPRSSIAALVGVNGSGKSTLFKALMGFVRV
GKGDIAILGQPVNRALRQNLVAYVPQAEEVDWSFPVLVEDVVMMGRYGHMGWLRRAKARD
HEIVDAALARVGMSEYRQRQIGELSGGQKKRVFLARAIAQQGKVILLDEPFTGVDVQTEA
RIIELLRELRDEGCTMLVSTHNLGSVSEFCDYTVMVKGTVLASGPTESTFTAENLELAFS
GVLRHVVLSGAEERIITDDERPFISRRAAGGER