Protein Info for BWI76_RS22375 in Klebsiella michiganensis M5al

Annotation: pectin acetylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF20434: BD-FAE" amino acids 101 to 266 (166 residues), 68.1 bits, see alignment E=1.7e-22 PF07859: Abhydrolase_3" amino acids 130 to 286 (157 residues), 44.5 bits, see alignment E=3.2e-15 PF00326: Peptidase_S9" amino acids 137 to 287 (151 residues), 45.7 bits, see alignment E=1.2e-15 PF01738: DLH" amino acids 235 to 290 (56 residues), 21 bits, see alignment E=4.3e-08

Best Hits

KEGG orthology group: K05968, [EC: 3.1.1.6] (inferred from 69% identity to eca:ECA2408)

Predicted SEED Role

"Xylanase" in subsystem Xylose utilization

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXE9 at UniProt or InterPro

Protein Sequence (315 amino acids)

>BWI76_RS22375 pectin acetylesterase (Klebsiella michiganensis M5al)
MTRLPLAAAIALLFSSQAAFSSLPTFSVWPGGEAPGAKNSPASESLVERSKDPSLPDRAV
TGVRAPTITIYAPEKPNGIALLVTPGGSYQRVVLDKEGSDLAPVFNARGYTLFVMTYRMP
ADGHAEGSDAPLADAQRALRTLRARAAEWHIDPHKIGIMGFSAGGHVAASLEIRYSEPAY
AAVDAIDQQSARPDFAVLGYPVISMDPAIAHPGSRKALIGETPTAERQHRYSPEQNVTPQ
TPPTFIFHAVDDPSVPVDNALVMFNALRAHQVPTELHLFAEGKHGFGIRGTRGLPAAEWP
QLAMNWIASLAEMNK