Protein Info for BWI76_RS22370 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator FhlA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 690 PF13185: GAF_2" amino acids 201 to 345 (145 residues), 39 bits, see alignment E=3.4e-13 PF01590: GAF" amino acids 202 to 344 (143 residues), 48.4 bits, see alignment E=5.1e-16 PF13492: GAF_3" amino acids 202 to 346 (145 residues), 40 bits, see alignment E=1.7e-13 PF00158: Sigma54_activat" amino acids 381 to 548 (168 residues), 242 bits, see alignment E=9.7e-76 PF14532: Sigma54_activ_2" amino acids 382 to 552 (171 residues), 77.7 bits, see alignment E=3.7e-25 PF00004: AAA" amino acids 405 to 523 (119 residues), 22.9 bits, see alignment E=3.6e-08 PF07728: AAA_5" amino acids 405 to 531 (127 residues), 31.1 bits, see alignment E=7.6e-11

Best Hits

Swiss-Prot: 84% identical to FHLA_SALTY: Formate hydrogenlyase transcriptional activator (fhlA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_01705)

Predicted SEED Role

"Formate hydrogenlyase transcriptional activator" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXJ1 at UniProt or InterPro

Protein Sequence (690 amino acids)

>BWI76_RS22370 transcriptional regulator FhlA (Klebsiella michiganensis M5al)
MSYTPMGDLGQQGLFDITRILLQQPDLAALSETLTGLVQQSALADRAAIILWHSGNHRAT
RHACDDAGHPVSYEDETVLANGPVRRLLSRPDALHCDSATFAETWPQLARSGLYPTFGYY
CLLPLAAEGRIFGGCEFIRDDNRPWTEKEYQRLHTFTQIVAVVTEQIQSRVSNNVDYDLL
CHERDNFRILVAITNAVLSRLDIDELVSEVAKEIHRYFRIDAISVVLRSNRKGKLNIYST
HYLDASHPVHDQSEVDEAGTLTERVFKSKEMLLLNLHEHDPLAPYEKMLFEMWDNKIQTL
CLLPLMSGNTLLGVLKLAQCDEKVFTTTNLKLLRQIAERVSIAIDNALAYREIQRLKERL
VDENLALTEQLNNVESEFGEIIGRSEAMNSVLKQVEMVAHSDSTVLILGETGTGKELIAR
AIHNLSGRNSRRMVKMNCAAMPAGLLESDLFGHERGAFTGASAQRIGRFELADKSSLFLD
EVGDMPVELQPKLLRVLQEQEFERLGSNKLIHTDVRLIAATNRDLKQMVADREFRSDLYY
RLNVFPIHLPPLRERPDDIPLLVKAFTFKIARRLGRNIDSIPAETLRLLSRMEWPGNVRE
LENVIERAVLLTRGSVLQLSLPEMNIEPQPLAAEVLPEEGEDEYQLIVRVLKESNGVVAG
PKGAAQRLGLKRTTLLSRMKRLGIHKDQLQ