Protein Info for BWI76_RS22345 in Klebsiella michiganensis M5al

Annotation: hydrogenase maturation nickel metallochaperone HypA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01155: HypA
  • amino acids 1 to 113 (113 residues), 108.5 bits, E=9.9e-36
• TIGR00100: hydrogenase nickel insertion protein HypA
  • amino acids 1 to 116 (116 residues), 137.5 bits, E=1e-44

Best Hits

Swiss-Prot: 93% identical to HYPA_KLEP3: Hydrogenase maturation factor HypA (hypA) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K04651, hydrogenase nickel incorporation protein HypA (inferred from 92% identity to kpn:KPN_03063)

MetaCyc: 77% identical to hydrogenase 3 nickel incorporation protein HypA (Escherichia coli K-12 substr. MG1655)
RXN-22650

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation protein HypA" in subsystem NiFe hydrogenase maturation

MetaCyc Pathways

• NiFe(CO)(CN)₂ cofactor biosynthesis (9/10 steps found)

Sequence Analysis Tools

See A0A285AXL2 at UniProt or InterPro

Protein Sequence (116 amino acids)

>BWI76_RS22345 hydrogenase maturation nickel metallochaperone HypA (Klebsiella michiganensis M5al)
MHEITLSQRALEIIEQQAQQAGARRVTGVWLKVGAFSCVEASALTFCFELVCRGTLAEGC
ELHIAEQQAECWCETCQQYVHLISQHVRRCPQCQSDRLQIVADDGLQIQRIEVTQE