Protein Info for BWI76_RS22285 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF00356: LacI" amino acids 3 to 48 (46 residues), 73.3 bits, see alignment 2.1e-24 PF00532: Peripla_BP_1" amino acids 60 to 278 (219 residues), 74 bits, see alignment E=3e-24 PF13407: Peripla_BP_4" amino acids 65 to 277 (213 residues), 63.9 bits, see alignment E=3.5e-21 PF13377: Peripla_BP_3" amino acids 171 to 330 (160 residues), 109.5 bits, see alignment E=3.9e-35

Best Hits

Swiss-Prot: 76% identical to ASCG_ECOLI: HTH-type transcriptional regulator AscG (ascG) from Escherichia coli (strain K12)

KEGG orthology group: K03487, LacI family transcriptional regulator, asc operon repressor (inferred from 89% identity to kpn:KPN_03050)

Predicted SEED Role

"AscBF operon repressor" in subsystem Beta-Glucoside Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXC4 at UniProt or InterPro

Protein Sequence (337 amino acids)

>BWI76_RS22285 transcriptional regulator (Klebsiella michiganensis M5al)
MATMLEVAKRAGVSKATVSRVLSGNGYVSQETKDRVFQAVAESGYRPNLLARNLATKKTQ
TLGLVVTNTLYHGVYFSELLYHVARMTEDKGRQLILADGKHSAEEEREAIQYLLDLRCDA
IIIYPRFLSVDEMDEIIENHERPIMVLNRRLRRNASHCVWSDQKASATMAVEKLIALGHR
DIAFITGSLDSPTGVERLSGYKDALARHSIAVNNDLIVEGRWTPETGAAGVETLRQRRVG
YSALVASNDDMAVGAMKQLHQLGVKVPEQVSVVGFDDIVLAPYMVPALSSVKVPVTEMIK
ESINRLIFMLDGGDLKFQQTFPGELIERDSMVPGPHA