Protein Info for BWI76_RS22250 in Klebsiella michiganensis M5al

Annotation: nitric oxide reductase transcription regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 PF01590: GAF" amino acids 24 to 157 (134 residues), 46.4 bits, see alignment E=1.7e-15 PF13185: GAF_2" amino acids 26 to 154 (129 residues), 29.6 bits, see alignment E=2.2e-10 PF00158: Sigma54_activat" amino acids 187 to 353 (167 residues), 228.4 bits, see alignment E=1.3e-71 PF14532: Sigma54_activ_2" amino acids 188 to 358 (171 residues), 80.8 bits, see alignment E=3.6e-26 PF00004: AAA" amino acids 211 to 342 (132 residues), 22.7 bits, see alignment E=3.6e-08

Best Hits

Swiss-Prot: 90% identical to NORR_KLEP3: Anaerobic nitric oxide reductase transcription regulator NorR (norR) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K12266, anaerobic nitric oxide reductase transcription regulator (inferred from 90% identity to kpe:KPK_1083)

Predicted SEED Role

"Functional role page for Anaerobic nitric oxide reductase transcription regulator NorR" in subsystem Nitrosative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXD0 at UniProt or InterPro

Protein Sequence (514 amino acids)

>BWI76_RS22250 nitric oxide reductase transcription regulator (Klebsiella michiganensis M5al)
MSFSVEALAKIAIDLQSDLGHADRFSRLITTLRQILGCDASALLRYEAHQFVPLAIDGLA
QDVLGRRFALEGHPRLEAIARAGDVVRFPADSSLPDPYDGLIPGQESLKVHACVGLPLFA
GQTLIGALTLDGMDADRFDSFSDEELRLIAALVAGALNNALLIARLESQNVLPEQAIVYP
PAERQEIIGLSAPMLQLKKEIDIVAASDLNVLISGETGTGKELVAKAVHQGSPRAVNPLV
YLNCAALPESVAESELFGHVKGAFTGAISNRSGKFEMADNGTLFLDEIGELSLALQAKLL
RVLQYGDIQRVGDDRSLRVDVRVLAATNRDLRQEVVEGRFRADLYHRLSVFPLSVPALRE
RENDVVLLAGYFCEQCRLRMGLAQVILSEATRARLLAWPWPGNVRELEHAIHRAVVLARA
TQAGNDIVLEPQHFQLAGEAPALPGVSPQPAAEAVSLREATEAFQREAIASALAANGRSW
AAAARALGLDVANLHRLAKRLGLKGSRPDKSSAG