Protein Info for BWI76_RS22220 in Klebsiella michiganensis M5al

Annotation: PTS glucitol/sorbitol transporter subunit IIB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 153 to 171 (19 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 263 to 286 (24 residues), see Phobius details amino acids 302 to 324 (23 residues), see Phobius details TIGR00825: PTS system, glucitol/sorbitol-specific, IIBC component" amino acids 3 to 325 (323 residues), 608.6 bits, see alignment E=1.3e-187 PF03612: EIIBC-GUT_N" amino acids 4 to 177 (174 residues), 232 bits, see alignment E=4.5e-73 PF07663: EIIBC-GUT_C" amino acids 232 to 324 (93 residues), 149 bits, see alignment E=3.7e-48

Best Hits

Swiss-Prot: 90% identical to PTHB_ECOLI: PTS system glucitol/sorbitol-specific EIIB component (srlE) from Escherichia coli (strain K12)

KEGG orthology group: K02782, PTS system, glucitol/sorbitol-specific IIB component [EC: 2.7.1.69] K02783, PTS system, glucitol/sorbitol-specific IIC component (inferred from 90% identity to eci:UTI89_C3065)

MetaCyc: 90% identical to sorbitol-specific PTS enzyme IIBC1 component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-169 [EC: 2.7.1.198]; TRANS-RXN-156 [EC: 2.7.1.198, 2.7.1.197]

Predicted SEED Role

"PTS system, glucitol/sorbitol-specific IIB component and second of two IIC components (EC 2.7.1.69)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.197 or 2.7.1.198 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXB8 at UniProt or InterPro

Protein Sequence (325 amino acids)

>BWI76_RS22220 PTS glucitol/sorbitol transporter subunit IIB (Klebsiella michiganensis M5al)
MTRIRIEKGAGGWGGPLELDAVADKKIVYITAGTRPAIVDKIARLTGWQAVDGFKEGEPP
EAEIGVAIIDCGGTLRCGIYPKRRIPTINIHATGKSGPLAQYIVEDIYVSGVKEENIFAL
EEGHSPAPQAAPAQPAARDYDTSKKITEQSDGLLAKVGMGMGSVVAVLFQAGRDTIDTVL
KTILPFMAFVSALIGIIMASGIGDWIAHGLAPLASHPLGLVTLALICSFPLLSPFLGPGA
VIAQVIGVLIGVQIGLGNIPPHLALPALFAINAQAACDFIPVGLSLAEARQDTVRVGVPS
VLVSRFLTGAPTVLIAWFVSGFIYQ