Protein Info for BWI76_RS22200 in Klebsiella michiganensis M5al
Annotation: iron ABC transporter
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 93% identity to eae:EAE_01535)Predicted SEED Role
"Zinc ABC transporter, inner membrane permease protein ZnuB" in subsystem Transport of Zinc
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285AXB9 at UniProt or InterPro
Protein Sequence (287 amino acids)
>BWI76_RS22200 iron ABC transporter (Klebsiella michiganensis M5al) MIWHTFIQPFIEFGFMRRALLVCLALSLSTTMLGVFLLLRRMSLMGDALSHAILPGVAAG YLLNGMSLLAMTVGGFIAGIAVALVAGWVSRRTPLKEDASFAGFYLGSLALGVTLVSLRG SNVDLLHLLFGSILAVDSDSAVFVSGVASLTLIGIALFYRGLVSEAFDSVWLQVNARRLP ALLHGLFLALLVLNLVAGFQVLGTLMAVGVMMLPAIAARCWARTLPGILLLAALIGGFCA WMGLSLSWAANLPAGPAIVLTASGIFFISVFFGTRSRLVVGWRKLMG