Protein Info for BWI76_RS22185 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02464: CinA
  • amino acids 8 to 160 (153 residues), 198.8 bits, E=2e-63
• TIGR00199: amidohydrolase, PncC family
  • amino acids 13 to 158 (146 residues), 204.9 bits, E=3.2e-65

Best Hits

Swiss-Prot: 87% identical to PNCC_ECOL6: Nicotinamide-nucleotide amidohydrolase PncC (pncC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03743, (no description) (inferred from 93% identity to kpe:KPK_1095)

MetaCyc: 87% identical to NMN aminohydrolase (Escherichia coli K-12 substr. MG1655)
Nicotinamide-nucleotide amidase. [EC: 3.5.1.42]

Predicted SEED Role

No annotation

MetaCyc Pathways

• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.42

Sequence Analysis Tools

See A0A285AXI0 at UniProt or InterPro

Protein Sequence (165 amino acids)

>BWI76_RS22185 hypothetical protein (Klebsiella michiganensis M5al)
MTDSELMQLSEQVGQALKARGATVTTAESCTGGWVAKTLTDIAGSSAWFERGFVTYSNEA
KSQMIGVSEATLLEHGAVSEPVVVEMAIGALRAARADYAISVSGIAGPDGGSAEKPVGTV
WFGVASASGQGVTRRECFAGDRESVRRQATAYALNLLWQQFLQNT