Protein Info for BWI76_RS22180 in Klebsiella michiganensis M5al

Annotation: recombinase RecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR02012: protein RecA" amino acids 6 to 326 (321 residues), 570.2 bits, see alignment E=6.5e-176 PF00154: RecA" amino acids 9 to 270 (262 residues), 474.9 bits, see alignment E=1.4e-146 PF08423: Rad51" amino acids 38 to 228 (191 residues), 36.5 bits, see alignment E=6.6e-13 PF06745: ATPase" amino acids 42 to 205 (164 residues), 31.9 bits, see alignment E=1.8e-11 PF21096: RecA_C" amino acids 273 to 328 (56 residues), 83.7 bits, see alignment E=1.6e-27

Best Hits

Swiss-Prot: 98% identical to RECA_KLEP3: Protein RecA (recA) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K03553, recombination protein RecA (inferred from 97% identity to kpn:KPN_03031)

MetaCyc: 94% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXE6 at UniProt or InterPro

Protein Sequence (352 amino acids)

>BWI76_RS22180 recombinase RecA (Klebsiella michiganensis M5al)
MAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMG
RIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQP
DTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLA
GNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDNVVG
SETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYSGDKIG
QGKANAISWLKENPAAAKEIEKKVRELLLSNQDATPDFAVDGNSEAETEQDF