Protein Info for BWI76_RS22080 in Klebsiella michiganensis M5al

Annotation: AzlC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 78 to 95 (18 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 208 to 237 (30 residues), see Phobius details PF03591: AzlC" amino acids 27 to 167 (141 residues), 133.9 bits, see alignment E=2.6e-43

Best Hits

Swiss-Prot: 83% identical to YGAZ_ECOLI: Inner membrane protein YgaZ (ygaZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 85% identity to kva:Kvar_1057)

MetaCyc: 83% identical to L-valine exporter, YgaZ component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-269

Predicted SEED Role

"FIG00638108: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXA0 at UniProt or InterPro

Protein Sequence (248 amino acids)

>BWI76_RS22080 AzlC family protein (Klebsiella michiganensis M5al)
MENSDALTHTPPAAEATLAEGLKDSLPIVISYIPVAFAFGLNATKLGFTPLESLFFSCII
YAGASQFVIVAMLAAGSSLWVAALTVMAMDVRHVLYGPSLRSRIPRALSNKKTAIWAFGL
TDEVFAAATAKLVRDGRRWSESWMIGIAFLSWASWVFGTLIGAYSGSGLLTDFPAVEAAL
GFMLPALFMSFLLASFQRKQSLSVTAALAGALGGMILFSIPAAILAGIVCGCLTALVQAS
LQGMPDEQ