Protein Info for BWI76_RS22075 in Klebsiella michiganensis M5al

Annotation: glycine betaine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04069: OpuAC
  • amino acids 30 to 313 (284 residues), 182.3 bits, E=6.8e-58

Best Hits

Swiss-Prot: 86% identical to PROX_ECO57: Glycine betaine/proline betaine-binding periplasmic protein (proX) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 90% identity to eae:EAE_01445)

MetaCyc: 86% identical to glycine betaine ABC transporter periplasmic binding protein ProX (Escherichia coli K-12 substr. MG1655)
RXN-8638 [EC: 7.6.2.9]; 7.4.2.- [EC: 7.6.2.9]

Predicted SEED Role

"L-proline glycine betaine binding ABC transporter protein ProX (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.9

Sequence Analysis Tools

See A0A285AX99 at UniProt or InterPro

Protein Sequence (331 amino acids)

>BWI76_RS22075 glycine betaine ABC transporter substrate-binding protein (Klebsiella michiganensis M5al)
MRHTAILATALTALISTTAFAADLPGKGITVKPIQSTISEETFQTLLVSRALEKLGYTVD
KPSEVDYNVGYTSLASGDATFTAVNWQPLHDDMYAAAGGDKKFYRQGVFVNGAAQGYLID
KKTAEQYHIKSIDQLKDPKIAKLFDTNGDGKADLTGCTPGWGCEAVINHQLDAYGLNNTV
THNQGNYAAMMADTIARYKEGKPVIYYTWTPYWVSDVLKPGKDVVWLQVPFSSLPGVQKN
IDTKLSNGANYGFPVSTMHIVANKAWAEKNPAAAKLFSIMKLPIADINAENAMMHEGHGS
EADIQGHVDGWIKAHQQQFDGWVNEALAAQK