Protein Info for BWI76_RS22065 in Klebsiella michiganensis M5al

Annotation: glycine betaine/L-proline ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 TIGR01186: glycine betaine/L-proline transport ATP binding subunit" amino acids 36 to 394 (359 residues), 619.5 bits, see alignment E=9.5e-191 PF00005: ABC_tran" amino acids 44 to 192 (149 residues), 125.4 bits, see alignment E=2.5e-40 PF00571: CBS" amino acids 347 to 392 (46 residues), 23 bits, see alignment 8.5e-09

Best Hits

Swiss-Prot: 93% identical to PROV_SALTY: Glycine betaine/proline betaine transport system ATP-binding protein ProV (proV) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_01435)

MetaCyc: 92% identical to glycine betaine ABC transporter ATP binding subunit ProV (Escherichia coli K-12 substr. MG1655)
RXN-8638 [EC: 7.6.2.9]; 7.4.2.- [EC: 7.6.2.9]

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXC7 at UniProt or InterPro

Protein Sequence (400 amino acids)

>BWI76_RS22065 glycine betaine/L-proline ABC transporter ATP-binding protein (Klebsiella michiganensis M5al)
MAIKLEIKNLYKIFGEHPQRAFKYIDKGLSKEQILEKTGLSLGVKNASLTIEEGEIFVIM
GLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPH
MTVLDNAGFGMELAGVPTQERQEKALEALRQVGLENYAHAYPDELSGGMRQRVGLARALA
INPDILLMDEAFSALDPLIRTEMQDELTKLQARHQRTVVFISHDLDEAMRIGDRIAIMQN
GEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRSPVGLIRKTPGFGPRSAL
KLLQDEDREYGYVIERGNKFVGIISIDSLKAALSEGQGIDAALIDSPQAVDAQTPLSELL
SHVGHAPCAVPVIDEGQQYVGIISKRMLLQALDREGANNG