Protein Info for BWI76_RS22055 in Klebsiella michiganensis M5al

Annotation: ribonucleotide-diphosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 714 TIGR04170: ribonucleoside-diphosphate reductase, class 1b, alpha subunit" amino acids 15 to 714 (700 residues), 1211.7 bits, see alignment E=0 PF08343: RNR_N" amino acids 16 to 97 (82 residues), 93.8 bits, see alignment E=8.1e-31 PF00317: Ribonuc_red_lgN" amino acids 99 to 171 (73 residues), 59.6 bits, see alignment E=3.8e-20 TIGR02506: ribonucleoside-diphosphate reductase, alpha subunit" amino acids 103 to 696 (594 residues), 519.3 bits, see alignment E=1.5e-159 PF02867: Ribonuc_red_lgC" amino acids 176 to 694 (519 residues), 530.1 bits, see alignment E=9.6e-163

Best Hits

Swiss-Prot: 85% identical to RIR3_ECOLI: Ribonucleoside-diphosphate reductase 2 subunit alpha (nrdE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to eae:EAE_01425)

MetaCyc: 84% identical to ribonucleoside-diphosphate reductase 2 subunit alpha (Salmonella enterica enterica serovar Typhimurium)

Predicted SEED Role

"Ribonucleotide reductase of class Ib (aerobic), alpha subunit (EC 1.17.4.1)" in subsystem Ribonucleotide reduction (EC 1.17.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.4.1

Use Curated BLAST to search for 1.17.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AX85 at UniProt or InterPro

Protein Sequence (714 amino acids)

>BWI76_RS22055 ribonucleotide-diphosphate reductase (Klebsiella michiganensis M5al)
MATTTAERITSEAPDFHALNAMLNLYDSNGRIPFDKDHQAVAAFMASHVAPNTVPFASQD
DKLTWLVAEGYYDARVLARYDRQFILELFAHARDGGFRFQTFLGAWKFYTSYALKTFDGK
RYLEDFADRTCMVALALAQGNETLAHQLTDEILSGRFQPATPTFLNAGKQQRGELVSCFL
LRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVVPVMKMLED
AFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFQLA
KEDAQMALFSPYDVERLYGKAFGDIAVSEMYAQLVADERVSKRWIRARDLFQRLAEIQFE
SGYPYIMFEDTVNRANPIAGRINMSNLCSEILQVNSPSTFDENLDYASIGQDISCNLGSL
NIAHTMDSPDFARTVEVAVRGLTAVSEMSDIRSVPSVAAGNAASHAIGLGQMNLHGYLAR
EGIAYGSEAGLDFTNFYFYTITWHALRTSMLIAREKGTRFAGFEQSRYASGDYFRPYLEG
DWQPKTATVRALFARAGIVLPDRDMWRQLRDDVMRYGIYNRNLQAVPPTGSISYINHATS
SIHPIVSKIEIRKEGKTGRVYYPAPFMTNDNLALYQDAYEIGPQKIIDTYAEATRHVDQG
LSLTLFFPDTATTRDINKAQIYAWKKGIKTLYYIRLRQLALEGTEIEGCVSCAL