Protein Info for BWI76_RS22020 in Klebsiella michiganensis M5al

Annotation: L-alanine exporter AlaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06610: AlaE
  • amino acids 4 to 141 (138 residues), 222 bits, E=1.5e-70

Best Hits

Swiss-Prot: 82% identical to ALAE_ECOLI: L-alanine exporter AlaE (alaE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_01390)

MetaCyc: 82% identical to AlaE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-469

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

See A0A285AXB6 at UniProt or InterPro

Protein Sequence (151 amino acids)

>BWI76_RS22020 L-alanine exporter AlaE (Klebsiella michiganensis M5al)
MFSAQSRLRHAVADTFAMVVYCTVVNMMIEIFLSGMTFQQSLSSRLVAIPVNIIIAVPYG
FYRDFAMRQARRISASGWMKNIADVVAYVTFQSPVYVAILLVVGADWHQIAAAVSSNIVV
SMMMGAAYGYFLDYCRRLFRVSPLPAGQSLS