Protein Info for BWI76_RS21995 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 99 PF12840: HTH_20" amino acids 21 to 68 (48 residues), 34.4 bits, see alignment E=5e-12 PF01022: HTH_5" amino acids 24 to 68 (45 residues), 52.8 bits, see alignment E=8.4e-18 PF12802: MarR_2" amino acids 25 to 68 (44 residues), 35.5 bits, see alignment E=2.6e-12 PF01047: MarR" amino acids 25 to 68 (44 residues), 25.3 bits, see alignment E=3.5e-09 PF13412: HTH_24" amino acids 26 to 68 (43 residues), 41.7 bits, see alignment E=2.1e-14

Best Hits

Swiss-Prot: 76% identical to YGAV_ECOLI: Probable HTH-type transcriptional regulator YgaV (ygaV) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 80% identity to kpn:KPN_02995)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXB7 at UniProt or InterPro

Protein Sequence (99 amino acids)

>BWI76_RS21995 transcriptional regulator (Klebsiella michiganensis M5al)
MNTPEQLQASAGEAAALLKAMSHPSRLLILCMLCDAPGTSAGELARITGLSPSATSQHLA
RMRDEGLIGCERQAQRIHYFITRPAVRHIVTTLKSIYCP