Protein Info for BWI76_RS21990 in Klebsiella michiganensis M5al

Annotation: ATPase AAA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 PF01590: GAF" amino acids 55 to 188 (134 residues), 34.1 bits, see alignment E=9.2e-12 PF00158: Sigma54_activat" amino acids 309 to 461 (153 residues), 199.6 bits, see alignment E=7.8e-63 PF07728: AAA_5" amino acids 318 to 436 (119 residues), 22.1 bits, see alignment E=3.3e-08 PF14532: Sigma54_activ_2" amino acids 318 to 466 (149 residues), 54.5 bits, see alignment E=3.9e-18 PF02954: HTH_8" amino acids 554 to 586 (33 residues), 35 bits, see alignment (E = 2.3e-12)

Best Hits

KEGG orthology group: None (inferred from 77% identity to kva:Kvar_1078)

Predicted SEED Role

"Formate hydrogenlyase transcriptional activator" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXC1 at UniProt or InterPro

Protein Sequence (594 amino acids)

>BWI76_RS21990 ATPase AAA (Klebsiella michiganensis M5al)
MPGNPFALTPEIEASPLLSDSWCRSQRYGLDPATDDFPRLHASELAERLASHSRLQTLAQ
PVVNALSRKVNDLQSVVVLSDASGLVLQTFGDTHAMQKAQRFALAPGNLWSESGRGTNAI
GTALAIDDSCEIDGRQHFLTSNRGLYCAAVPLQSPDGNIAGVLDISGPAHYPHARTLSWV
KGAAKQIEYLWFKQSLHPQQWLMSLHPQPEKLDGVDELLLVFTDAVLTAANRLAMREFSL
NAEQFGHLTFQQLFPRLRQTAVSIPLPLAAGDRHYYYRLRAPATASVAVTPRPGIDLLFS
SQREGEKLLRLLNAGIGLCIEGETGCGKEYVSRTLHRHSRWSGGKFVAINCAAIPESLIE
SELFGYQPGAFTGANKNGYIGKIREADGGVLFLDEIGDMPLTLQTRLLRILQEKEVTPLG
ASRSSPVNFAVICATHRNLAQRVAEGTFREDLLYRLREFALTLPPLREWPELPAFIQRLW
RDLGGEKRRVALGPALVQHLATQPWPGNVRQLQSLMRVLLALAEEGETLAVGDLPQEYRS
SPAPRPPRGLQQHDAQLIADTLASYNGNISKAAQALGVARSTLYRRAARRGSRF