Protein Info for BWI76_RS21975 in Klebsiella michiganensis M5al

Annotation: fimbrial protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF00419: Fimbrial" amino acids 50 to 197 (148 residues), 78 bits, see alignment E=5e-26

Best Hits

KEGG orthology group: K07345, major type 1 subunit fimbrin (pilin) (inferred from 74% identity to kpe:KPK_1142)

Predicted SEED Role

"Type-1 fimbrial protein, A chain precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXA6 at UniProt or InterPro

Protein Sequence (198 amino acids)

>BWI76_RS21975 fimbrial protein (Klebsiella michiganensis M5al)
MKTQFRIMAMFVGALVSASALSSPSQPASSAMTVNPGSNAGTQGTGGQVEFTGSITDSSC
NVDSTSANQSVDLGKWASSYFTGAGSETTKTAFHIKVKDCPSTVTTVSVLFDGTRDTNNS
DLLAINGTASGVAIKLYEDDKSTPVDLGAVSRGHSVTAGASGAATGTADLEFFADYVSTS
AVSAGSANGTANFNMVYN