Protein Info for BWI76_RS21935 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 105 to 129 (25 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details amino acids 347 to 366 (20 residues), see Phobius details amino acids 372 to 391 (20 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 347 (328 residues), 98.4 bits, see alignment E=2.2e-32 amino acids 222 to 389 (168 residues), 42.7 bits, see alignment E=1.8e-15

Best Hits

KEGG orthology group: None (inferred from 81% identity to ddc:Dd586_3026)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AX69 at UniProt or InterPro

Protein Sequence (397 amino acids)

>BWI76_RS21935 MFS transporter (Klebsiella michiganensis M5al)
MSAEITLPVGQQNQNIIRLATAQALAGANSVVFYATGAIVGNAIAPSPTLATLPVTIFVL
GMAACILPFGALARRRGRKTVFMTGTGAGVLTGVLAALAVVLGSFWLFCIAAFFGGAYAA
VAVSFRFAATDGVSGERRARALSLVMGGGVAAGVIGPMLVTGTMNLWPSHTFAMTFIAQG
LVAALSALVLLGVKTAAPVAQTQSGGRPLGEIVRQPGFSRTVFSGAISYMVMNFLMTAAP
LSMHMHGIPQQASNLGIQWHVIAMYGPGFFTGKLINRFGARRINAAGLILLVLSVMVGLA
GIDVMHYWLSLILLGIGWNFGFTGASAQIMDFHRPEEKTQVQSLNDFIVFGVMMIGSFSS
GALMNLFGWNAVLWGSLAPVVVALAALLVGGRAAQRV