Protein Info for BWI76_RS21915 in Klebsiella michiganensis M5al

Annotation: short-chain dehydrogenase/reductase SDR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00106: adh_short" amino acids 8 to 197 (190 residues), 146.5 bits, see alignment E=1.5e-46 PF01370: Epimerase" amino acids 10 to 143 (134 residues), 25 bits, see alignment E=2.3e-09 PF08659: KR" amino acids 11 to 165 (155 residues), 31.3 bits, see alignment E=3.9e-11 PF13561: adh_short_C2" amino acids 14 to 259 (246 residues), 137.7 bits, see alignment E=9.8e-44

Best Hits

KEGG orthology group: None (inferred from 88% identity to eae:EAE_01280)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AX59 at UniProt or InterPro

Protein Sequence (264 amino acids)

>BWI76_RS21915 short-chain dehydrogenase/reductase SDR (Klebsiella michiganensis M5al)
MNIDLSGKVALVTASTGGIGFAIAKGLAASGAEVIINGRSERSVSAALARLQNAVPGATT
RPAIADLSSAEGVNLLVQAVSGVDILVNNAGIYGPQDFYETDDATWENYWQTNVMSGVRL
SRALLPAMVQQGWGRVVFISSESARNIPADMIHYGVTKTAQLSLARGLAKFVAGSGVTVN
SVLPGPTISDGFAEMMKDEVAKTGKSLEQLAKEFVMANRPSSVIQRAATVEEVANMVVYV
CSTQASATSGAALRVDGGVVDDIV