Protein Info for BWI76_RS21880 in Klebsiella michiganensis M5al

Annotation: agmatinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00491: Arginase
  • amino acids 36 to 308 (273 residues), 297 bits, E=7.9e-93
• TIGR01230: agmatinase
  • amino acids 36 to 308 (273 residues), 197.8 bits, E=1.4e-62

Best Hits

Swiss-Prot: 76% identical to GBUA_PSEAE: Guanidinobutyrase (gbuA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01480, agmatinase [EC: 3.5.3.11] (inferred from 96% identity to kpn:KPN_02973)

MetaCyc: 77% identical to guanidinobutyrase subunit (Pseudomonas putida)
Guanidinobutyrase. [EC: 3.5.3.7]

Predicted SEED Role

"Agmatinase (EC 3.5.3.11)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.11)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• superpathway of L-arginine and L-ornithine degradation (13/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (11/11 steps found)
• superpathway of polyamine biosynthesis I (7/8 steps found)
• L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (2/2 steps found)
• putrescine biosynthesis I (2/2 steps found)
• superpathway of putrescine biosynthesis (3/4 steps found)
• L-arginine degradation X (arginine monooxygenase pathway) (2/3 steps found)
• L-arginine degradation IX (arginine:pyruvate transaminase pathway) (1/4 steps found)
• L-arginine degradation VIII (arginine oxidase pathway) (1/4 steps found)
• L-arginine degradation XII (1/4 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.3.11

Use Curated BLAST to search for 3.5.3.11 or 3.5.3.7

Sequence Analysis Tools

See A0A285AX60 at UniProt or InterPro

Protein Sequence (316 amino acids)

>BWI76_RS21880 agmatinase (Klebsiella michiganensis M5al)
MDNVFHQPQGGNEMPRFGGRATMMRLPFIDNLQGLDAAFVGIPLDIGTSQRSGTRYGPRY
IRTESVMIRPYNMATGAAPFDSLSVADIGDVPINTYNLLKSVQIIEDYYTGLNSFPLIPL
TLGGDHTITLPILRALTKKHGPVGLIHIDAHTDTNDEMFGEKIAHGTTFRRAVEEGLLDL
KRVVQIGQRAQGYAAGDFQWGVDRGFRLVQAEQCWHKSLAPLMAEVRQQMGDGPVYLSFD
IDSLDPIWAPGTGTPEVGGLTSIQALEIVRGCRGLNLIGCDLVEVSPPYDVSGNTSQLAA
NLLYEMLCVLPGVKYP